Protein Info for NIAGMN_16805 in Escherichia coli ECRC102

Name: hybG
Annotation: hydrogenase maturation factor HybG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00074: hydrogenase assembly chaperone HypC/HupF
  • amino acids 1 to 78 (78 residues), 100.4 bits, E=2e-33
• PF01455: HupF_HypC
  • amino acids 1 to 72 (72 residues), 81.4 bits, E=2.1e-27

Best Hits

Swiss-Prot: 100% identical to HYBG_ECOLI: Hydrogenase maturation factor HybG (hybG) from Escherichia coli (strain K12)

KEGG orthology group: K04653, hydrogenase expression/formation protein HypC (inferred from 100% identity to eco:b2990)

MetaCyc: 58% identical to hydrogenase maturation factor HypC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HybG" in subsystem NiFe hydrogenase maturation

Protein Sequence (82 amino acids)

>NIAGMN_16805 hydrogenase maturation factor HybG (Escherichia coli ECRC102)
MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLLGQWVLVHVGFAMSII
DEDEAKATLDALRQMDYDITSA