Protein Info for NIAGMN_06425 in Escherichia coli ECRC102
Name: cyoC
Annotation: cytochrome o ubiquinol oxidase subunit III
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYOC_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 100% identity to eco:b0430)MetaCyc: 100% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]
Predicted SEED Role
"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)
MetaCyc Pathways
- D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
- NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
- NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
- glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
- proline to cytochrome bo oxidase electron transfer (1/2 steps found)
- pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
- succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.10.3.-
Use Curated BLAST to search for 1.10.3.- or 7.1.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (204 amino acids)
>NIAGMN_06425 cytochrome o ubiquinol oxidase subunit III (Escherichia coli ECRC102) MATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL SLFWHFLDVVWICVFTVVYLMGAM