Protein Info for NIAGMN_05610 in Escherichia coli ECRC102

Name: entH
Annotation: proofreading thioesterase EntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00369: uncharacterized domain 1" amino acids 19 to 134 (116 residues), 156.6 bits, see alignment E=1.2e-50 PF03061: 4HBT" amino acids 50 to 127 (78 residues), 68.7 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 100% identical to ENTH_ECO5E: Proofreading thioesterase EntH (entH) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 99% identity to eco:b0597)

MetaCyc: 99% identical to proofreading thioesterase in enterobactin biosynthesis (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"Proofreading thioesterase in enterobactin biosynthesis EntH" in subsystem Siderophore Enterobactin

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>NIAGMN_05610 proofreading thioesterase EntH (Escherichia coli ECRC102)
MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDIRTHQPFGLLHGGASAA
LAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFD
EQGRRCCTCRLGTAVLG