Protein Info for NIAGMN_03945 in Escherichia coli ECRC102

Name: artM
Annotation: arginine ABC transporter permease ArtM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 5 to 110 (106 residues), 61 bits, see alignment E=6.3e-21 PF00528: BPD_transp_1" amino acids 33 to 214 (182 residues), 54.2 bits, see alignment E=7.8e-19

Best Hits

Swiss-Prot: 100% identical to ARTM_ECO57: Arginine ABC transporter permease protein ArtM (artM) from Escherichia coli O157:H7

KEGG orthology group: K09998, arginine transport system permease protein (inferred from 100% identity to eco:b0861)

MetaCyc: 100% identical to L-arginine ABC transporter membrane subunit ArtM (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, permease protein ArtM" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>NIAGMN_03945 arginine ABC transporter permease ArtM (Escherichia coli ECRC102)
MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL
LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG
QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL
YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN