Protein Info for NIAGMN_03740 in Escherichia coli ECRC102

Name: opgE
Annotation: phosphoethanolamine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 54 to 203 (150 residues), 165.7 bits, see alignment E=7.4e-53 PF00884: Sulfatase" amino acids 233 to 522 (290 residues), 219.6 bits, see alignment E=6.1e-69

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to ecf:ECH74115_1318)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>NIAGMN_03740 phosphoethanolamine transferase (Escherichia coli ECRC102)
MIKKISINFLFLMLMIDVVFATLFNIPVWMHLFNIINNLDGVKLGFIISLPVFLISALNF
VFTPFSFRYIFKPFFCILFICSSIVTYATMKYGVQFDKTMMQNIFETNAGEMTSYFNMSV
VLWFLFTGILPCGLLLLVNIRYPETWIKGITYRLISMFASLLIIFAIAFFFYKDYASVGR
NNSSLNKEIIPTNYIYSGFKYVRDFFVSPGEFRQTGTDASRTINEKQKPVIMFLVVGETA
RSQNYALNGYSRGTNDFTKKYNELISFHNVQSCGTSTAISVPCMFSDMKRKEFNSRKAVN
SENVLDILYRTGVNLLWIENDGGCKGVCKRIPTINIEPSNSDNTLCKKNSCYDEVMLKNI
DEYINNNSEDKLIVFHLMGSHGPTYYLRYPESHKYFKPTCDRSDIENCTHEQLINTYDNT
IRYTDYIISKLIDKLIEYKDEYDTVLLYVSDHGESLGENGLYLHGTPYNVAPAEQTHVPL
ITWMSPGFVSSKKIDLNCLSEHALNRTVSHDNIFSSLLGLWNVNTSVYNKEDDIISSCR