Protein Info for NIAGMN_00385 in Escherichia coli ECRC102

Name: pntA
Annotation: Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 169 to 191 (23 residues), see Phobius details amino acids 402 to 418 (17 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 453 to 472 (20 residues), see Phobius details amino acids 478 to 500 (23 residues), see Phobius details TIGR00561: NAD(P)(+) transhydrogenase (AB-specific), alpha subunit" amino acids 2 to 510 (509 residues), 1045.7 bits, see alignment E=0 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 165.5 bits, see alignment E=1.2e-52 PF01262: AlaDh_PNT_C" amino acids 141 to 368 (228 residues), 241.8 bits, see alignment E=7.9e-76 PF12769: PNTB_4TM" amino acids 427 to 509 (83 residues), 122.1 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 99% identical to PNTA_ECOLI: NAD(P) transhydrogenase subunit alpha (pntA) from Escherichia coli (strain K12)

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 100% identity to eok:G2583_1997)

MetaCyc: 99% identical to pyridine nucleotide transhydrogenase subunit alpha (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-277 [EC: 7.1.1.1]

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2 or 7.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>NIAGMN_00385 Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha (Escherichia coli ECRC102)
MRIGIPRERLTNEPRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEG
NSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPR
ISRAQSLDALSSMANIAGYRAIVEAAHEFGCFFTGQITAAGKVPPAKVMVIGAGVAGLAA
IGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAFIKAEME
LFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVIVDLAAQNGGNCEYTVPGEI
FTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKNGNITVDFDDVVIRGVTV
IRAGEITWPAPPIQVSAQPQVAQKAAPEVKTEEKCACSPWRKYALMALAIILFGWLASVA
PKEFLGHFTVFALACVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGQGGWVSF
LSFIAVLIASINIFGGFTVTQRMLKMFRKN