Protein Info for MPMX26_03173 in Acinetobacter radioresistens SK82

Annotation: Sensor protein QseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details PF00512: HisKA" amino acids 219 to 278 (60 residues), 46.1 bits, see alignment E=4.2e-16 PF02518: HATPase_c" amino acids 327 to 434 (108 residues), 78.6 bits, see alignment E=5.1e-26

Best Hits

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 56% identity to aby:ABAYE0733)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>MPMX26_03173 Sensor protein QseC (Acinetobacter radioresistens SK82)
MQKRYSLQKRLVIYISLFSVVLGCVLIFAAYRIALEEINEVLDKQMQSLAERIAENHPEP
LQSEIDLGKQYSEEDLFVDIWSYTDTTLHPQDVLVASVKKAGFYTHQTPYGTWLTYIIPG
DQLQIQVSQQKNVRQDLALELAVNMFLPYVLFLPFAIFGLSWVIRRSFQPLIDFKTELAS
RKAQELKPIEMKEYPLELEPTIEEMNYLFGRISLAQQEQRQFVADSAHELRTPLTALNLQ
LQILLQQFPQSDALHNLSLGILRMQHLVNQLLSLAKQDVTEGLTEPVQSLSLNQMTVACI
EQLIQLALQKEIDLGVEQQQELLIQGQASALHSIIYNLIDNAIKYSPEHGVINVSILQQG
RQAVLQIEDSGAGIDPAQFNQIRQRFYRIHNHAEIGSGLGLSIVDKATERLGGTLEFSRS
TNLSGLCVQVKLPLIEA