Protein Info for MPMX26_03164 in Acinetobacter radioresistens SK82

Annotation: Thiol:disulfide interchange protein DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 239 to 266 (28 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 359 to 387 (29 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 432 to 450 (19 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details PF11412: DsbD_N" amino acids 11 to 118 (108 residues), 98 bits, see alignment E=9.5e-32 PF02683: DsbD_TM" amino acids 239 to 452 (214 residues), 215.7 bits, see alignment E=1.3e-67 PF00085: Thioredoxin" amino acids 528 to 631 (104 residues), 26.5 bits, see alignment E=1.3e-09 PF13098: Thioredoxin_2" amino acids 537 to 636 (100 residues), 29.1 bits, see alignment E=2.7e-10

Best Hits

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>MPMX26_03164 Thiol:disulfide interchange protein DsbD (Acinetobacter radioresistens SK82)
MVAVLIRTAHADFLPPDQAFQFEAVSTSQEGAELTWKIADGYYLYHHQLKVSHDQKALKL
SLPVPQDKDDPTFGRTQVHYGQVNTHIPVQPNQQLNIQWQGCAESGLCYPVQRTTIQTDD
EGLLPTQRFSESKRLLNVTSTLTSTLVPTQLSEQAVAQQKKAALGPENSTNKNTVEEPEN
LVAVPQDEQAADESQRQASSEVSTQREPQIQQDQTNASLKSQWNNDQFFFNLLSNQNLLV
NLLVFLGLGILLAFLPCSLPLIPILSGILVQRKTGYRAAFIAGAFVLGLAIVYAVMGLAV
AQLGYSFQRWFQSPVFIGLFALLFTVFAFNLFGAFHLSLPQGVLHRLDQWQQRQKGGTLL
GALLMGMIAALIVGPCMSAPLAGALLFVSQLNQPVMGASYLFVLGLGIGFPIFIASVFGS
QYLPKPGLWMDRLKFSFGFVMLALALYFIRPLIPSVLYFILLGAVLLLLAGYCLLKILPH
ISRSIAKAMVMILSIMIALGGAWHINHALAQMSVTQAEQILAWQQVNTEDELSSALARFK
GQTVIIDVYADWCVACQPIEHEVLPREDVQDALRNIARIKLDLTNYHSSQDELLKQWQIL
GPPTMIMLDVSHQEQRELRLTGTFSAAQLLARLEQLQTGERE