Protein Info for MPMX26_03134 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF13173: AAA_14" amino acids 24 to 152 (129 residues), 106.8 bits, see alignment E=8.4e-35 PF13635: DUF4143" amino acids 207 to 353 (147 residues), 65.7 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K07133, (no description) (inferred from 50% identity to smb:smi_1780)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>MPMX26_03134 hypothetical protein (Acinetobacter radioresistens SK82)
MRSANIRRDGYLKFLNTWQNRDVIKVLSGVRRSGKSTLLAMFQQDLKAQGVQAENIIAIN
FEFMEFEELTDYRKLHDYVLSKVDKSKKNYVFLDEIQHVTNFEKVVDSLYVRDYIDLYIT
GSNAFFLSGELATLLTGRYIEQHVLPLSFQEFKQWHIENNPIIQQLSNRDLYAMYTRSSF
PYTLAMTSQQETYDYLQAVYASVMFKDVIPRLNTADINSLERVARYLASVTGSPISINKI
KNTFVSSGVKISFETVKRYIQGLQDSLLFYSAAQFKVRGRELLQSSEKYYLVDVGLRRIM
LPDANADQGHILENVIYLELIRRGYTVYVGRVDEYEIDFVAVDTLKNLTYYQVALETLNE
ETLSRELRPLQKISDSYPKYLLTLDTIGAEANYNGIVKMSALDWLLSENK