Protein Info for MPMX26_03132 in Acinetobacter radioresistens SK82

Annotation: Glucosaminate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01292: thioredoxin-disulfide reductase" amino acids 7 to 312 (306 residues), 402.3 bits, see alignment E=4.8e-125 PF07992: Pyr_redox_2" amino acids 7 to 301 (295 residues), 177.2 bits, see alignment E=1.3e-55 PF13738: Pyr_redox_3" amino acids 59 to 284 (226 residues), 57.7 bits, see alignment E=3.1e-19 PF00070: Pyr_redox" amino acids 147 to 223 (77 residues), 58.7 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 73% identical to TRXB_VIBCH: Thioredoxin reductase (trxB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 94% identity to aby:ABAYE3661)

MetaCyc: 69% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX26_03132 Glucosaminate ammonia-lyase (Acinetobacter radioresistens SK82)
MQKRHSKLIILGSGPAGYSAAVYAARANLKPTLIAGLQLGGQLTTTTEVDNWPGDPEGLT
GPALMERMQAHAERFGTEIVYDHINEVDLSVRPFVLKGDMEEFTCDALIIATGATAQYLG
LESEAQFMGQGVSACATCDGFFYKNQKVMVVGGGNTAVEEALYLSNIASHVTLVHRRDSL
RSEKILQDHLFEKQKEGKISILWNNQVDEVLGDNTGVTGVCLKSTVDGLTQDVEVQGLFV
AIGHKPNTEMFAEQLELRDGYIQVQSGTAGNATATSVPGVFAAGDVADSVYRQAITSAGS
GCMAALDAEKYLDSLS