Protein Info for MPMX26_03114 in Acinetobacter radioresistens SK82

Annotation: Transcriptional regulatory protein CusR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 94.7 bits, see alignment E=4e-31 TIGR01387: heavy metal response regulator" amino acids 3 to 221 (219 residues), 337.1 bits, see alignment E=2.2e-105 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 83.4 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 67% identical to IRLR_BURP2: Transcriptional activator protein IrlR (irlR) from Burkholderia pseudomallei (strain 1026b)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 95% identity to abn:AB57_0661)

Predicted SEED Role

"Copper-sensing two-component system response regulator CusR" in subsystem Cobalt-zinc-cadmium resistance or Copper homeostasis or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>MPMX26_03114 Transcriptional regulatory protein CusR (Acinetobacter radioresistens SK82)
MRILLVEDEQKTGDYLKQGLSEAGYITDWVTDGLTGKHQALSEEYDLIILDVMLPGLNGW
NIINDIRSSGKTMPILFLTARDQIEDRVKGLELGADDYLVKPFAFAELLARIKTLLRRGQ
QREDNNIIKIADLELDLRKRRVTRAGQRIDLTAKEFALMELFMRRRGEILPRALIASQIW
DMNFDSDTNVVEVAIKRLRNKVDSNFTPKLIQNIRGMGYVLEVEDE