Protein Info for MPMX26_02979 in Acinetobacter radioresistens SK82

Annotation: Pantothenate precursors transporter PanS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 268 to 293 (26 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 304 (291 residues), 88.1 bits, see alignment E=6.8e-29 PF01758: SBF" amino acids 43 to 220 (178 residues), 165.4 bits, see alignment E=1.3e-52

Best Hits

Swiss-Prot: 54% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 83% identity to aby:ABAYE0060)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX26_02979 Pantothenate precursors transporter PanS (Acinetobacter radioresistens SK82)
MAALLRLTQFIQKTFALWVVLFAGVALLVPEAFVWLKAYITWMLGIIMFGMGMTMTPNDF
KSVLQSPKAVIIGVAAQFVVMPGLAFILCKLFQLPPEIAIGVILVGCCPGGTASNVITYM
AKGNTALSVACTSVSTLLAPIFTPAIFYVLASQWIEINAASMLVSILQVVLFPILLGLIV
RSLLKQKVEQYIQVMPLVSVVAIVAIVAAIIGGSKASILESGLMILGVVMLHNTLGYLLG
FWASRLFKLPYADSKAVAIEVGMQNSGLGVALAAVHFAASPVTAVPSAIFSLWHNISGPA
LATYWASRTRQEVAPQRHEE