Protein Info for MPMX26_02939 in Acinetobacter radioresistens SK82
Annotation: Protein YffB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 66% identity to aci:ACIAD3528)Predicted SEED Role
"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)
MetaCyc Pathways
- arsenate detoxification III (1/2 steps found)
- arsenic detoxification (bacteria) (2/4 steps found)
- arsenate detoxification I (3/6 steps found)
- arsenic detoxification (plants) (2/6 steps found)
- arsenic detoxification (yeast) (4/12 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.20.4.1
Use Curated BLAST to search for 1.20.4.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (106 amino acids)
>MPMX26_02939 Protein YffB (Acinetobacter radioresistens SK82) MKKAFDLLNELNLPYEFHDYKKQGIDKETLKEWLEQMGADVILNKKGTTWRKLSETEQQK ALESEEQLLQTLITHTSLVKRPVLKTPQGYVVGFDEFSYRTLAERS