Protein Info for MPMX26_02899 in Acinetobacter radioresistens SK82

Annotation: Inner membrane protein YjcH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details PF04341: DUF485" amino acids 11 to 96 (86 residues), 102.4 bits, see alignment E=5.3e-34

Best Hits

KEGG orthology group: None (inferred from 82% identity to aci:ACIAD3464)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>MPMX26_02899 Inner membrane protein YjcH (Acinetobacter radioresistens SK82)
MDELKVERILQNPKFKEMVAKKRNLSWTLTAIMLFVYVGFMLLVGYNKEFLMSSFSGGVT
TWGIPLGLGIIVLSFVLCAVYSYIANNTLDELNREALKEVEAIAQESTTTKGMH