Protein Info for MPMX26_02889 in Acinetobacter radioresistens SK82

Annotation: Inner membrane transport protein YajR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 349 (336 residues), 143.9 bits, see alignment E=6.1e-46 PF00083: Sugar_tr" amino acids 38 to 183 (146 residues), 30.2 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: None (inferred from 87% identity to aci:ACIAD3450)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>MPMX26_02889 Inner membrane transport protein YajR (Acinetobacter radioresistens SK82)
MMNALERRSTFALSSIFALRMLGLFMIIPVFSVAGQSYQYATPALLGLAVGVYGLSQAIL
QIPFSLLADRFSRKPLIVIGLLLFALGGAIAAMSETIYGVIIGRAIAGGGAVSAVVMALL
ADVTREEQRTKAMAVMGMSIGLSFVVAFSLGPWLTGIVGISGLFWVTTVMGLLAILMLFM
VPKVTRHHKNFSQGYLQQLKQVLKMGDLNRLHFSVFSLHLLLTAMFVYIPSQLIEFAHIP
LASHGMVYLPLLVVSLFFAFPSIILAEKYRKMRGIFLTAITGVILGLLIMIFGFESKYIL
LTGLGFFFIAFNVMEALLPSWLSKSAPLQSKATAMGVNASGQFLGAFFGGTLGGFLLTLH
NTSLGWSILTAIAIIWLFISFGLAQPRYLTSLVLSLPEMQETDEWTSKLLAIRGIEEVVV
MPEQQLAYIKVDKQQVDAAARHNLTQLLGKEVAI