Protein Info for MPMX26_02840 in Acinetobacter radioresistens SK82

Annotation: Succinyl-CoA:coenzyme A transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF02550: AcetylCoA_hydro" amino acids 11 to 215 (205 residues), 109.6 bits, see alignment E=4.4e-35 TIGR03458: succinate CoA transferase" amino acids 12 to 494 (483 residues), 780.5 bits, see alignment E=2.9e-239 PF13336: AcetylCoA_hyd_C" amino acids 321 to 463 (143 residues), 138 bits, see alignment E=5.2e-44

Best Hits

KEGG orthology group: K01076, [EC: 3.1.2.-] (inferred from 90% identity to aci:ACIAD3390)

Predicted SEED Role

"Acetyl-CoA hydrolase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>MPMX26_02840 Succinyl-CoA:coenzyme A transferase (Acinetobacter radioresistens SK82)
MSLDRIRLASLHDKVISADQAAEFIQDGMTIGMSGFTRAGEAKAIPQALVKRAKQHPLKI
SLITGASLGNDLDKQMTEAGVLARRMPFQVDNTLRRAINNGEVMFIDQHLSETVEQMRNL
QLKRPDIAVIEAVAITEDGHIVPTTSVGNSASFAIFAEKVIIEINTSVSEEFEGLHDIYI
PTYRPTRTPVPLTQVDDRIGSTAIPIDPAKIVGIVFNETPDSPSTVTPPDVETQAIANHL
INFFEKEVADGRLPKNLGPLQAGIGSIANAVLTGFKDSNFEDLVMYSEVLQDCTFELIDA
GKMKFASGCSMTLSTQCGERVFGNLEAYKDKFVLRPQEISNHPELVRRLGIIGINTALEF
DIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGDISSIVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARVIIENCVHPLYKDALNDYFDRSTAKGGHTPHLLRE
ALQWHINFEENGHMLAVEPAVKTA