Protein Info for MPMX26_02775 in Acinetobacter radioresistens SK82

Annotation: Threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF03151: TPT" amino acids 11 to 222 (212 residues), 30.6 bits, see alignment E=2.3e-11 PF00892: EamA" amino acids 131 to 263 (133 residues), 71.6 bits, see alignment E=7.4e-24

Best Hits

KEGG orthology group: None (inferred from 72% identity to acd:AOLE_01680)

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MPMX26_02775 Threonine/homoserine exporter RhtA (Acinetobacter radioresistens SK82)
MISYQISASFAKQLFSVLDPLTVTILRLCFAAVLVTLMFRSWRIISRLPYLRWRDLLCYS
ASLGLMNILFYLSLDKLPQGIAVGLEFAGPLGLALLSVKYRSDYIWVLLAIIGIVLMVPW
GSANAENFSVFGAACALGAGFCWAIYIYFGQKVVQQNIGMHALTIAIIISALALLPIGLY
QDAPALVQTQHWGKVLMVALLATAIPYALDLLALKSLSKLSYGTLSSLSPALAALAGMVL
LKEQINTWQWIALGCIMLASVGVTVGTSKRSRQPVTDF