Protein Info for MPMX26_02774 in Acinetobacter radioresistens SK82

Annotation: Threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 121 to 137 (17 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00892: EamA" amino acids 12 to 134 (123 residues), 28.5 bits, see alignment E=7.5e-11 amino acids 147 to 278 (132 residues), 61.4 bits, see alignment E=5.5e-21

Best Hits

KEGG orthology group: None (inferred from 72% identity to aci:ACIAD3303)

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>MPMX26_02774 Threonine/homoserine exporter RhtA (Acinetobacter radioresistens SK82)
MLNIKQAPHLQALLLLILAMLSVQGSGSFAKVLISEFPVITVAALRLMFSALILAAVFQI
WKINLRNIRWKAILSYGLALAGMNLLFYLSIARLPLGIAVAFEFIGPLSVALFFARQRYD
FIWIGLAVLGLLLLLPLDETQQSLDLLGIAYALGAGACWAVYIIAGQKPSGISGNHTVCL
GMMVGTCCLLPAALLFTPATLSAFELPHIGSFIVLAILASALPFSLEMIALRNLTALSFG
TLMSLEPAIAAFSGFLFLGEQLLWSQWLALATIIAASIGCTVTTQRARLRAQAKESSASS
N