Protein Info for MPMX26_02727 in Acinetobacter radioresistens SK82

Annotation: GTP-binding protein EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 45 to 230 (186 residues), 245.8 bits, see alignment E=1.3e-77 PF01926: MMR_HSR1" amino acids 64 to 182 (119 residues), 61.5 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 82% identical to ENGB_ACIAD: Probable GTP-binding protein EngB (engB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03978, GTP-binding protein (inferred from 80% identity to aci:ACIAD3228)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MPMX26_02727 GTP-binding protein EngB (Acinetobacter radioresistens SK82)
MHRSSGKSKNSKTAQAPRQKISYEKALDPAITEYSVRALNWLRKAEFLMSAPKLSLCVED
TGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFSLGNPDQRLVDLPGYG
YAAVPETMKIVWQKELENYLIHRESLQGLVLLMDIRHPLQHFDTMMLEWAHSRKLFVHIL
LTKADKLNRGPANKTLLEVKQELKKMKLNFSIQLFSSLNKQGLEELASVMAGRLNFTLEQ
STQFDLDSIPEAVEEDEADTVEELEDFLPEQHAEQKPE