Protein Info for MPMX26_02651 in Acinetobacter radioresistens SK82

Annotation: Dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 2 to 317 (316 residues), 124.9 bits, E=1.4e-39
• PF13738: Pyr_redox_3
  • amino acids 5 to 302 (298 residues), 36.5 bits, E=1e-12
• PF00070: Pyr_redox
  • amino acids 169 to 241 (73 residues), 46.8 bits, E=1.1e-15
• PF02852: Pyr_redox_dim
  • amino acids 342 to 448 (107 residues), 57.9 bits, E=3.3e-19

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 66% identity to abc:ACICU_03185)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• glycine biosynthesis II (2/3 steps found)
• glycine cleavage (2/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (460 amino acids)

>MPMX26_02651 Dihydrolipoyl dehydrogenase (Acinetobacter radioresistens SK82)
MYDLIIVGAGTAGIGAYKEAIKHTQNILIINDGSWDTTCARVGCMPSKVLISSANRMHDI
HHADEVGLEAKSKINTAHVMPHVRRLRDQFVKATLMDVKSWNEAHKISGQAHFIDANTIE
VNSQHYQAKSFIVAVGSTPSFDIKWKKELQDRLITSDDIFELETLPNSLAVVGSGVIALE
LAQAMQRLNVKTTIFARSQRIGNLSSPELQKIAQQEFAKELSILYNTLPEQVVKTEYGVK
LSYQQNGKFKDLEVDYLLVATGRKSLLNILKLDQIHSDFKDIKNLPVHPETKQLAEYPIF
IVGDAYTDTPIQHEAAQEGKLAVHNCLSYPHIQPIKLFTPLSIVFSQPEMAIIGKSYQQL
VKAGSQFVTGEVFYEKQGRAIVLGKNVGKVEVYVDKQTKQLLGAELLVNKAEHFAHLLNW
MMAENITIDHLLAKPFYHPTMEEGLRTALKHARRQLNVLN