Protein Info for MPMX26_02637 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details PF01062: Bestrophin" amino acids 1 to 283 (283 residues), 285.1 bits, see alignment E=3.4e-89

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 87% identity to abc:ACICU_03170)

Predicted SEED Role

"probable membrane protein STY1534"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>MPMX26_02637 hypothetical protein (Acinetobacter radioresistens SK82)
MIVREQPDVLKLLFSWRGTILPKILPPLGIVMLISAIVGGIEYIDLYRFPEVPLAGFTLI
GVVLSIFLGFKNTACYDRWWEARRLWGILIANARHFDRDCRVLPQARRERIIQHVIVFAN
VLRDRLRHQTANPTELLQTSGMSQQALTQLYQHHNAPQYTLSLIQWELLLALKEGEISDI
IYTQMNQNVAALSEVQTGCDRIANTPLPFAYSVLLNRTVYCFCFLLPFSLGQTLGLLTPF
LVGLLAYTFLGLDALSTELEEPFGTQSNDLPLDSMVRLIEIELLGTLGKPTPPPIQAQDD
NLL