Protein Info for MPMX26_02631 in Acinetobacter radioresistens SK82

Annotation: Small ribosomal subunit biogenesis GTPase RsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00157: ribosome small subunit-dependent GTPase A
  • amino acids 92 to 342 (251 residues), 237.8 bits, E=6.5e-75
• PF03193: RsgA_GTPase
  • amino acids 114 to 285 (172 residues), 179.1 bits, E=7.5e-57
• PF01926: MMR_HSR1
  • amino acids 219 to 284 (66 residues), 30 bits, E=5e-11

Best Hits

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 83% identity to abc:ACICU_00540)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (352 amino acids)

>MPMX26_02631 Small ribosomal subunit biogenesis GTPase RsgA (Acinetobacter radioresistens SK82)
MALIRKRRLTEQQQRRIQKQQKTRQEEIDTSNDLEGLVVQHYGRQLEVEALSVPVEHPPQ
PVTQPGEPEPFWKPVELGSIWRCHTRTNLELLVTGDRVKWQADPNTGLGIITAIHPRSSL
LTRPDRYHKVKPVAANISLIVVVFAVLPEPAPMLIDRYLVACADAEIPALLVLNKTDLLS
QNDPILQLVSEYEALGYEVMQTQSKGDLSALAKRLDGETVAFVGQSGVGKSSLINAIVPD
ASQKTNIISENSALGQHTTTSTRLIRFGTSGALIDSPGIREFGLWHLDADKVQRGFPEIE
NLLGHCQFRNCTHTHEKHCALREAAKNGEILPRRLESYLRLQDEIAEAQQKN