Protein Info for MPMX26_02619 in Acinetobacter radioresistens SK82

Annotation: Vitamin B12 transporter BtuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 49 to 155 (107 residues), 90.6 bits, see alignment E=9e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 226 to 575 (350 residues), 137.7 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 63% identity to acd:AOLE_02850)

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>MPMX26_02619 Vitamin B12 transporter BtuB (Acinetobacter radioresistens SK82)
MSILFQPTRLVGAIAIAMGCSPAIFAEDTTISAQLDPIVVTASKSAEKASEVPARITIIE
PEVLEQSPIASLPQLLQTDAAINMVQSGGYGQIASIFLRGGKSDQALILRDGVRLNSATS
GTASLAFIDTTDIQQIEVLKGPASVLYGTDAISGVVQLISKTPEKTSAFITGEIGEDKTY
KSVIGADLVENDFYAQIRGQRLETDGTPIKDIKNAPNASFDQKGYSAKIGVDKENYAASV
DYSENEGYSDYDNYGNLISQDFKNEIINVKGRINILENLALNARISQFKDDIDQNSSSDY
VHSKTQEAEIYSQWGFTPNQKLLLGVTHRNIDGDVISYGTPYQEDVNSTGYYIQHKYDQA
GLNTQVGLRVEDNEKFGTHTVAQGSVRYQVLPLTSVYGNIGSAFKAPTLNDMYAYGGNPD
LKPEESLSYEIGLDQKLAYNISTGLSLYITQVDNLIDFDGILNQMRNLDKAKMEGSELYV
KWQGKNLFTNLSYNYVRAKNKNNDEDLSRRPRQNIALTAGWRDEHYIFSTTMLANGHYDN
SAFDDVQIPGHFRVDIHGQYQINNHINIFTNIQNVSDSKYRTAYGSGSYYINGGRLASAG
VTFRY