Protein Info for MPMX26_02544 in Acinetobacter radioresistens SK82

Annotation: NADH-quinone oxidoreductase subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 427 to 453 (27 residues), see Phobius details amino acids 477 to 494 (18 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 8 to 509 (502 residues), 521.3 bits, see alignment E=1.2e-160 PF00361: Proton_antipo_M" amino acids 138 to 437 (300 residues), 221.8 bits, see alignment E=5.8e-70

Best Hits

Swiss-Prot: 62% identical to NUOM_ECOLI: NADH-quinone oxidoreductase subunit M (nuoM) from Escherichia coli (strain K12)

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 87% identity to aci:ACIAD0742)

MetaCyc: 62% identical to NADH:quinone oxidoreductase subunit M (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>MPMX26_02544 NADH-quinone oxidoreductase subunit M (Acinetobacter radioresistens SK82)
MENNLILPALILVPFIAGFICWLVDKLDQHLPRWIALIGMLVTLGLTIALWQTGTYDYSL
GQKVPTWSAEFALPWIQTLGINIHLAVDGLSLLMVGLTALLGVLAVGCSWGEIQKNVGFF
HLNLLWSLGGVIGVFLAIDMFLFFFFWEMMLVPIYFLIALWGHKGSNGRSRVYAATKFFI
YTQVAGLIMLIGILGLVIYGYMMTGTINFSYNYLLGVANALDTQLPSVAYAFMICMFIGF
AVKLPVFPLHGWLPDAHAQAPTAGSVDLAGILIKTAAYGLLRFVIPFFPAASADFANIAI
IFGLIGIFYGAWCAFQQTDMKRLLAYTSISHMGFVLLALYAGNILTFQGLMIMMLAHGLS
SAALFIMCGQIYERLHTRDMRLMGGIRGQFQYLPFFLMFFVAALVGIPGLGNFIGEFLIL
MGSYAKFPVFTILAAVSLVFAGLYGLILIHKALFGVPNEEQKQHYSHPLKDLNAREMVIL
LICALGLVWLGLYPQTFLDVSNSSMAWLANSYIPVQEVVDVTQQVSTQLENVEIQ