Protein Info for MPMX26_02526 in Acinetobacter radioresistens SK82

Annotation: Methionine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 TIGR00398: methionine--tRNA ligase" amino acids 4 to 533 (530 residues), 561 bits, see alignment E=2.8e-172 PF09334: tRNA-synt_1g" amino acids 4 to 394 (391 residues), 503.3 bits, see alignment E=1.5e-154 PF00133: tRNA-synt_1" amino acids 9 to 80 (72 residues), 32.3 bits, see alignment E=1.7e-11 PF19303: Anticodon_3" amino acids 412 to 513 (102 residues), 29 bits, see alignment E=3.2e-10 PF08264: Anticodon_1" amino acids 424 to 502 (79 residues), 26.8 bits, see alignment E=1.5e-09 TIGR00399: methionine--tRNA ligase, beta subunit" amino acids 559 to 685 (127 residues), 136.7 bits, see alignment E=4.8e-44 PF01588: tRNA_bind" amino acids 591 to 684 (94 residues), 90 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 87% identical to SYM_ACIAD: Methionine--tRNA ligase (metG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 89% identity to acd:AOLE_15780)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>MPMX26_02526 Methionine--tRNA ligase (Acinetobacter radioresistens SK82)
MRNILVTNALPYANGPIHMGHLLGYIQADIWVRAMRAMGHDVTYVCADDAHGTAIMLRAE
ANGITPEEQIANVQKEHIRDFNGFGVHFDHYDSTNSDTNKARSQEIYIKNREAGNIAVRP
VTQLFDPEKGMFLSDRFIKGTCPKCKTEDQYGDSCEACGTTYNATELINPKSTLSGATPV
EKSSDHYFFKLPNFSEYLQTWTRDSGRLPVSIANKLDEWFDAGLSDWDISRDAPYFGFEI
PDAPDKYFYVWVDAPIGYMSSFENYIQTKRPDLNFDDFWKKDSENEVYHFIGKDIVYFHA
LFWPAMLEGANYRTPTGLFVNGFLTVNGQKMSKSRGTFIKAETYLEHLNPEYLRYYFASK
LSDKVEDSDLNLDDFIQKVNSDLVGKVVNIASRCAKFINTKFDHKLSAECAEPELVQSFI
EAGDSIAKAYEAREFSTAIREIMALADRANQYIDEKKPWALAKIEGEELQVHNVCSVGIN
LFRQLAIYLAPVLPVLAQQVQDFLKLDSFNFESRKQILVNHEIELFQPLMQRVDPKAVTA
MVDASKESLGAPVAEPAKVEKKKEKAKEKKAEAQVGEADIIGIEDFIKVDLRVAEVLEAA
HVEGSDKLLQLTLNVGETEPRNVFSGIREFYQPEDLKGKLVVMVANLAPRKMRFGVSNGM
VLAAGNGEGVWVISPENGAKPGDKVS