Protein Info for MPMX26_02461 in Acinetobacter radioresistens SK82

Annotation: Cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF04354: ZipA_C" amino acids 198 to 325 (128 residues), 94.9 bits, see alignment E=1.8e-31

Best Hits

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>MPMX26_02461 Cell division protein ZipA (Acinetobacter radioresistens SK82)
MEVTTLIGIIVAVIIILVGLRMMLKKPNTAPSLESELYIDPQSNKPVIPRHVRDQLQASE
SAVTPTVRKEPQLDQSSATQQSVPTAGQHSKQASEPEVSASQSVSTDKAETRAQPEAPAE
AIALSETQAQVKKVEKTTSESTEVADGSEPKEPEFSLNPTIETAEIAEFDGESNILDVHL
HEQQRCDDESALATAQQIIALNVYPNPRRALSGDKALKVLLKYGLRYGEMSCFHRYEKTE
EQSPLMFSVLRITDEGPAGFDLESLSTEQVQGLAFFLALPNPNAITGFDMMTSIAGLIAR
EIDGKVYDEQNLEFTPQLKEHWRHQVIDYRPDHVSV