Protein Info for MPMX26_02305 in Acinetobacter radioresistens SK82

Annotation: Ion-translocating oxidoreductase complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 5 to 144 (140 residues), 190 bits, see alignment E=1.5e-60 PF04060: FeS" amino acids 15 to 47 (33 residues), 34.6 bits, see alignment 3.2e-12 PF14697: Fer4_21" amino acids 85 to 139 (55 residues), 65.9 bits, see alignment E=6.9e-22 PF00037: Fer4" amino acids 86 to 107 (22 residues), 28.2 bits, see alignment (E = 3e-10) amino acids 117 to 137 (21 residues), 21.2 bits, see alignment (E = 4.9e-08)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 78% identity to acd:AOLE_14210)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>MPMX26_02305 Ion-translocating oxidoreductase complex subunit B (Acinetobacter radioresistens SK82)
MNSTISMIRQIDALLPQTQCGLCGHRDGCLPYAQAIAEGEAANKCIPGGQPVADALAKLL
DRGALKAEESVWPIQADGRPQRMKAVIREDECIGCTKCISACPVDAIIGSGKLMHTVLTD
LCTGCELCIPPCPVDCIDLIEDVQPLPTEDLRIQEQNDLRRRYYAHIQREETRRMYRKGP
VVRAEIDSELFARFSQQTDAVPAIEVKQKDISVQNTVSAQTTIELAKIRTQIKKLEKQLS
VREDAQKQTQLIELNRQLQALQESSK