Protein Info for MPMX26_02303 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03724: META" amino acids 44 to 139 (96 residues), 50.2 bits, see alignment E=2.3e-17 amino acids 163 to 254 (92 residues), 46.7 bits, see alignment E=2.8e-16 PF14302: DUF4377" amino acids 273 to 362 (90 residues), 77 bits, see alignment E=8.3e-26

Best Hits

KEGG orthology group: None (inferred from 66% identity to aby:ABAYE2763)

Predicted SEED Role

"putative signal peptide"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>MPMX26_02303 hypothetical protein (Acinetobacter radioresistens SK82)
MKLKYLFLALLPFSLMACQSIQPHQKQPHVSQQTDTEQQLSAYSWTYQNSQASKPLVINF
IDNHQLSIQTGCNGQGGSWKIEEGKLVTSHLISTMMACQSDLMKQEQLSSSIFNEARSNF
DISLANGQAILTITDTKGQKHVFKGSKMLEHSALTSYNWTYQPEGSKEPILLNFSNDRIG
IDTGCNRQGTSWKIENGQILTGDLVSTQMACDPVLMKQEQFSSSLFQKRSIPFELNLANP
EQPTLILKDTQGQSYTFKGNMTPEAQYQSQGETIFLEIAPETKSCTGVAPQTCLQVREIK
YDDKGIKMQVDKDWTLFYDHIEGFKHDPNQRVIVRVKRYERKNVAADQSKYAYVHDMTVE
QETIKKP