Protein Info for MPMX26_02280 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR00252: TIGR00252 family protein" amino acids 5 to 131 (127 residues), 110.5 bits, see alignment E=2.5e-36 PF08378: NERD" amino acids 9 to 94 (86 residues), 29 bits, see alignment E=1.3e-10 PF02021: UPF0102" amino acids 12 to 102 (91 residues), 87 bits, see alignment E=9e-29

Best Hits

Swiss-Prot: 63% identical to Y1130_ACIB5: UPF0102 protein AB57_1130 (AB57_1130) from Acinetobacter baumannii (strain AB0057)

KEGG orthology group: K07460, putative endonuclease (inferred from 63% identity to abc:ACICU_01089)

Predicted SEED Role

"Endonuclease (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>MPMX26_02280 hypothetical protein (Acinetobacter radioresistens SK82)
MVTFTKQLGQWAEQQAKIFLEQQGFVFLNQNYHSRYGEIDLIVCRNQELIFVEVKARSMT
GYGRAQEVISRSKQKKIIQTAMSFISQHPVYENYYCRFDVICFNFSTQIAKKVQQDFYKL
PYDLEWIENAFTLD