Protein Info for MPMX26_02260 in Acinetobacter radioresistens SK82

Annotation: Argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00032: argininosuccinate synthase" amino acids 16 to 422 (407 residues), 541.5 bits, see alignment E=7.3e-167 PF00764: Arginosuc_synth" amino acids 16 to 163 (148 residues), 71.4 bits, see alignment E=9.6e-24 PF20979: Arginosuc_syn_C" amino acids 194 to 410 (217 residues), 111.5 bits, see alignment E=4.6e-36

Best Hits

Swiss-Prot: 96% identical to ASSY_ACIBT: Argininosuccinate synthase (argG) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 96% identity to abc:ACICU_01105)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MPMX26_02260 Argininosuccinate synthase (Acinetobacter radioresistens SK82)
MTDNATILQHVPVGKKVGIAFSGGLDTSAALLWMKQKGAEPYAYTANLGQPDEDDYDAIP
KKAENYGAVKARLIDCRLQLALEGIAAIQCGAFHISTGGMPYFNTTPLGRAVTGTMLVTA
MKEDDVNIWGDGSTYKGNDIERFYRYGLLTNPNLKIYKPWLDQTFIDELGGRAEMSQFLI
DNGFDYKMSKEKAYSTDSNMLGATHEAKDLEYLNAGIKIVEPIMGVAFWKDEVEVKAEEV
SVTFEEGMPVALNGQRFDNPVELILEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGM
ALLHITYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQALMLRETAQRWVAKAIT
GTVTLELRRGNDYTIMNTESPNLTYEAERLTMEKGDSMFTPMDRIGQLTMRNLDITDTRA
KLGLYTDSGLLSLGQGSALPQLENNKK