Protein Info for MPMX26_02238 in Acinetobacter radioresistens SK82

Annotation: Erythronate-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00389: 2-Hacid_dh" amino acids 29 to 272 (244 residues), 65.1 bits, see alignment E=7.9e-22 PF02826: 2-Hacid_dh_C" amino acids 116 to 253 (138 residues), 115.6 bits, see alignment E=2.7e-37 PF11890: DUF3410" amino acids 291 to 350 (60 residues), 54.1 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 67% identical to PDXB_ACIBT: Erythronate-4-phosphate dehydrogenase (pdxB) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 68% identity to acd:AOLE_04110)

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MPMX26_02238 Erythronate-4-phosphate dehydrogenase (Acinetobacter radioresistens SK82)
MKIVADENLAFTDYFFSDFAEIDHRAGRTLMHEDVKDADALLIRSVTRVNQQLIENTKLK
FVGSATIGTDHLDIPVLEKQQISWSNAAGCNAQAVAEYVITALLCLKPELLDAGKQFTLG
IIGLGNVGSRLAYMAELLDWQVIGYDPLVNHLAVTQVPLQELLASADAISLHVPLIKTGH
YPTHHLINAETLALMKTQAILVNSARGPVIEEQSLIHDIQTTHRLVVLDVFEHEPVISEE
LLKWVRLVTPHIAGYSLEGKARGTQMIYEAFCEKFGFMASKTFISQLPVCEQYFTEQTDI
KTVLKTCLGKIYDIARDDQNLRACLKDGRIDQQAFDHLRKTYPLRREWSAHGGPQA