Protein Info for MPMX26_02223 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 20 to 353 (334 residues), 114.6 bits, see alignment E=5.8e-37 PF01061: ABC2_membrane" amino acids 220 to 326 (107 residues), 38 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 70% identity to aci:ACIAD2651)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>MPMX26_02223 hypothetical protein (Acinetobacter radioresistens SK82)
MKQFLYFYLKTFKDIASNSSILTTLILSVFFYSFFYPTAYKAQTAEALPIVIVDEEQSLV
TSSIITEVAKSPNVKIQAITGNFAEAKLMIQKQQADGILLLPDQLSNSIRRGEVGGIGLY
LSAAYFLKTKQIGLGLATSVENAIAQQAEKFGEIAHFSPAVPIHQIPLFNTLSGYGSYIF
PAIAPLIIHQTIVLGLSMLIAGYREKLWRPVKSELSGLFFAILTIGCLGCLYLFGFTFWF
YDYPRGGNFWGMLLGVPIFISSVIGLAILVASYLDMPERAGHVIVFTSIPLFLLSGTAWP
HAAMPEWMQWLGVALPSTQGIQMFIQLNQMGVPTSLVLPKMIYLAAFAAVCLVWGNYRLS
YK