Protein Info for MPMX26_02206 in Acinetobacter radioresistens SK82

Annotation: Phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 12 to 339 (328 residues), 471.5 bits, see alignment E=7.5e-146 PF00586: AIRS" amino acids 64 to 169 (106 residues), 85.8 bits, see alignment E=2.8e-28 PF02769: AIRS_C" amino acids 181 to 341 (161 residues), 124 bits, see alignment E=6.4e-40

Best Hits

Swiss-Prot: 92% identical to PUR5_ACIAD: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 92% identity to aby:ABAYE0889)

MetaCyc: 69% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MPMX26_02206 Phosphoribosylformylglycinamidine cyclo-ligase (Acinetobacter radioresistens SK82)
MSNSTSTPNTGLSYKDAGVDIEAGDALVDRIKSVAKRTSRPEVMGGLGGFGALCKIPKGY
EEPVLVSGTDGVGTKLRLALNLNRHDTIGQDLVAMCVNDLLVCGAEPLFFLDYYATGHLN
VEVAANVVTGIGAGCELAGCALVGGETAEMPGMYEGEDYDLAGFCVGVVEQSKIIDGSKV
KADDVLIGIASSGAHSNGYSLLRKILDVKNVDLTQIVDGRPLADTAMEPTRIYVKPILEL
LKQVDVHAMAHITGGGLPGNLPRVLPNGAQAVINESSWEWPELFKLLQKEGGVEQFEMYR
TFNCGVGMVLAVDAADAERTVNTLNNLGEKAWIMGHIVDNAESVEGADEKNRVIFA