Protein Info for MPMX26_02194 in Acinetobacter radioresistens SK82

Annotation: Tol-Pal system protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 39 to 443 (405 residues), 500.3 bits, see alignment E=2.2e-154 PF04052: TolB_N" amino acids 48 to 143 (96 residues), 69.9 bits, see alignment E=2.9e-23 PF07676: PD40" amino acids 217 to 244 (28 residues), 19.8 bits, see alignment (E = 9e-08) amino acids 257 to 288 (32 residues), 27.8 bits, see alignment (E = 2.8e-10) amino acids 296 to 332 (37 residues), 44.9 bits, see alignment 1.2e-15 amino acids 388 to 413 (26 residues), 18.3 bits, see alignment (E = 2.7e-07)

Best Hits

Swiss-Prot: 83% identical to TOLB_ACIAD: Tol-Pal system protein TolB (tolB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03641, TolB protein (inferred from 85% identity to acd:AOLE_04355)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>MPMX26_02194 Tol-Pal system protein TolB (Acinetobacter radioresistens SK82)
MLQISIPIPQNHGIERPAIMNMTRKTLLALALTAVFSPAITTTAFAQLHLEIAKAPEEAP
KIAIAPFANDQSIYPIVESDLNRSGRFTSSSKNLPASAALNNINAQSWQAAKIPYVVTGS
IKSVAGDSYEVHYQLYDVEKQTYLLNELLTVPASRIRQAGHMISDAIYQALTGIPGDFSG
RIAYVLRNPATPEQRYTLQIADTDGEQPRTVLSSRDPILSPAWTPDAKKLAYVSFETKRP
AIYVQDLATGQREVLASFRGLNGAPSFSPDGQSMLFTASMHGNPEVYQMDLTTRQLKRMT
NNSAIDTEARYAPDGKSFIFTSDRGGSAQIYRYSFADGSVKRLTFKGAFNARGTLSADGK
KVALVHRPAGSNYKVAIQDIATGITNILTPTSLDESPSFSPNGQMVVYATREGNRGLLAI
MSTDGRFRMNLPSEQGEVREPAWTPK