Protein Info for MPMX26_02186 in Acinetobacter radioresistens SK82

Annotation: Holliday junction ATP-dependent DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF05496: RuvB_N" amino acids 20 to 178 (159 residues), 267 bits, see alignment E=1.3e-83 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 24 to 326 (303 residues), 469.5 bits, see alignment E=2e-145 PF00004: AAA" amino acids 56 to 178 (123 residues), 70.7 bits, see alignment E=4.1e-23 PF07728: AAA_5" amino acids 98 to 172 (75 residues), 24.6 bits, see alignment E=5.4e-09 PF17864: AAA_lid_4" amino acids 181 to 254 (74 residues), 113.3 bits, see alignment E=9.1e-37 PF05491: WHD_RuvB" amino acids 256 to 322 (67 residues), 79.7 bits, see alignment E=3.1e-26

Best Hits

Swiss-Prot: 95% identical to RUVB_ACIAD: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 95% identity to abn:AB57_2995)

MetaCyc: 70% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>MPMX26_02186 Holliday junction ATP-dependent DNA helicase RuvB (Acinetobacter radioresistens SK82)
MQDRLISGSEKPEDHFDRAIRPTSLDDYIGQPVVREQMGIFIGAARGRGEALDHTLIFGP
PGLGKTTLANIIAREMGGNLKSTSGPVLERAGDLAAMLTNLEEGDVLFIDEIHRLSPVIE
EILYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVAATTRAGLLTSPLRDRFGIVQRLEF
YSVEDLTHIVTRSASLMDVPITQEGSREVARRARGTPRIANRLLRRVRDYAQVKGTGEVT
QEMAQRALDMLNVDKDGLDTLDRRYLSMLLERFDGGPAGVEALAAAMAEDSGTLEDVIEP
YLIQQGYAMRTARGRIATNMAYLQFGMTPPEPKH