Protein Info for MPMX26_02169 in Acinetobacter radioresistens SK82

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 22 to 280 (259 residues), 330 bits, see alignment E=1.2e-102 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 26 to 283 (258 residues), 416.9 bits, see alignment E=3.4e-129 PF00528: BPD_transp_1" amino acids 89 to 281 (193 residues), 61.7 bits, see alignment E=4e-21

Best Hits

Swiss-Prot: 52% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 86% identity to aci:ACIAD2595)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>MPMX26_02169 Sulfate transport system permease protein CysW (Acinetobacter radioresistens SK82)
MSLTTNSNALAEKLQSRDATREAAWVRYLLLTIGLLFFLSCLVLPLILVFVEAFKQGVGV
YFQALVHPDTLSAVKLTLLTAAIAVPLNVVFGVAAAWCVAKFNFRGKSILTTIIDLPFSV
SPVIAGMMLVLIFGSQGWLGEWLIDNDIKILYATPAIVLATIFITVPFVARELIPLMESQ
GNEEEEAAIVLGASGWQTFWKVTLPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGET
NTLPLHVEILYNEYTFSAAFAVSSLLALLAIVTLILKTWVELGQEKQAKRNDDSASS