Protein Info for MPMX26_02108 in Acinetobacter radioresistens SK82

Annotation: Membrane-bound lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 35 to 327 (293 residues), 286 bits, E=1.6e-89
• TIGR02282: lytic murein transglycosylase B
  • amino acids 39 to 330 (292 residues), 302.3 bits, E=1.6e-94

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 83% identity to abn:AB57_2749)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (333 amino acids)

>MPMX26_02108 Membrane-bound lytic murein transglycosylase B (Acinetobacter radioresistens SK82)
MISLNIYKKFKQFSIGLSAAGIVAFSQANDFITHPNYEAFKTKTMQNYGLTAQQVDWAMQ
GSKNLPNIVNIMNRPGESKPWYEYKTNFMSAGTIKRGVTFKNQYADALNRAEQQFGVSKA
VILGILGVETGYGANKGSFVTRDALATLAFGYPRRAEYFSDELGALIAWTYKEGYPTSSI
IGSYAGAIGYPQFMPSNITKLGIDYDGNGHIDLRNSAVDAIGSIANYLAHHGWQRDQPIG
FAARYTGSNPDSIIATDLTQPVPYGVLKNKGISPLNPLVKIDDLDMVNIIQLQDSYGPVY
YITYPNFQVITTYNKSRMYATAVWQLGTEVADR