Protein Info for MPMX26_02021 in Acinetobacter radioresistens SK82

Annotation: Bifunctional chorismate mutase/prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 TIGR01807: chorismate mutase" amino acids 14 to 89 (76 residues), 89.6 bits, see alignment E=6.5e-30 PF01817: CM_2" amino acids 17 to 96 (80 residues), 80.1 bits, see alignment E=1.8e-26 PF00800: PDT" amino acids 101 to 278 (178 residues), 222.8 bits, see alignment E=4.6e-70 PF01842: ACT" amino acids 287 to 351 (65 residues), 49.2 bits, see alignment E=5.3e-17

Best Hits

Swiss-Prot: 56% identical to CMPDT_PSEAE: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 91% identity to abm:ABSDF1251)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>MPMX26_02021 Bifunctional chorismate mutase/prephenate dehydratase (Acinetobacter radioresistens SK82)
MGHDDQKNSSSFNLEQIRNEIDSVDQQLQELINRRASLAEAVAEAKFAAEENPLFYRPER
EAQVLRKVMERNDGPLSDVTMARLFREIMSACLALEAPQSIAFLGPEGTYTHSAVLKHFG
QDALVRPIATIDEVFREVEAGSAHYGVVPVENSSEGVVNHTLDCFRGSSLNVIGEVELRI
HHQFLVSENTRKDSIKQIYAHQQTLAQCRHWLDAHYPGVERVALNSNAEAARRIRNEWHS
AAIASDIAASLYNLEIMHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISAHDRAGAL
LEILAPFAKHNISLTSIETRPALPEKWAYVFFIDLEGHIEQENVAAAIKEIRPMVKELRV
LGSYPVAVL