Protein Info for MPMX26_02017 in Acinetobacter radioresistens SK82

Annotation: Peroxide stress resistance protein YaaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF03883: H2O2_YaaD" amino acids 1 to 241 (241 residues), 311.3 bits, see alignment E=4.2e-97 PF21818: DUF6884" amino acids 92 to 182 (91 residues), 31.2 bits, see alignment E=2.3e-11

Best Hits

Swiss-Prot: 80% identical to Y1173_ACIB3: UPF0246 protein ABBFA_001173 (ABBFA_001173) from Acinetobacter baumannii (strain AB307-0294)

KEGG orthology group: K09861, hypothetical protein (inferred from 80% identity to aby:ABAYE1212)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>MPMX26_02017 Peroxide stress resistance protein YaaA (Acinetobacter radioresistens SK82)
MLALISPAKTLDYESALPTDEHTLPRLLEHSQELIDFCRKLSASEIASLMSVSEKIAQLN
TARFQDWTPEFTFGNARQAIFAFKGDVYTGLDAYSLKHNNLNFAQQHLRMLSGLYGLLRP
LDLMMPYRLEMGTKLQNSRGHNLYEFWGDLITQQINQELTEHQHNYLINLASDEYYKAVQ
ENKIQAAIIKPIFLDQKNGKYKVISFYAKKARGLMARFIVENQLTQPEDLKAFNSEGYYL
DTVNSSAKELIFKRDEQPV