Protein Info for MPMX26_02004 in Acinetobacter radioresistens SK82

Annotation: Gamma-glutamylputrescine oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01494: FAD_binding_3" amino acids 62 to 99 (38 residues), 27.8 bits, see alignment 3.2e-10 PF01266: DAO" amino acids 64 to 419 (356 residues), 195.1 bits, see alignment E=5.2e-61 PF00890: FAD_binding_2" amino acids 64 to 175 (112 residues), 27.3 bits, see alignment E=4.3e-10 PF13450: NAD_binding_8" amino acids 67 to 106 (40 residues), 22.8 bits, see alignment 1.9e-08

Best Hits

KEGG orthology group: None (inferred from 79% identity to acd:AOLE_13925)

Predicted SEED Role

"D-amino acid oxidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>MPMX26_02004 Gamma-glutamylputrescine oxidoreductase (Acinetobacter radioresistens SK82)
MLNISKPIILNDVVFKQSTTQQAGKEWNWVNPRHLQADHPANYYESSLADWHEFNALQTD
CECDVVVIGSGLLGASTALHLAEQGVETVILEKNRVGSAASGRNGGQLTPGLARWEAGEM
AEHFGYEDAKKLWHFTSTEAMRLIDEISEKYGLDFQRKRGHITAAVHQGHLVGLTQGADA
RKYLGEDHTRIVGKHELGEYIKSDYYTGGLIDELGGQIHPLALNRGLIYAFCKNGGIVYE
QTEVIAIEEAEDGVYVRTATGTVKARKSVVMAVHHASFKLLPQKKQTTLPFYTYVSTTAP
LELDIHELLPEEHPVYDTQFQIDYYRPVTQNRLLFGGQGTGSCWSPEKTLNYLKNRIHTV
FPQLKQVEIDFVWSGTTDLTVNGAVDSRKFGSKFPIYAVHGWSGHGVAQTVRIGKAIAAD
FIGQSSDFKMLTQIDHANILFARTLAPVVIPIAKSAYGVGALMNPGKMVSF