Protein Info for MPMX26_01922 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 403 to 436 (34 residues), see Phobius details PF03929: PepSY_TM" amino acids 5 to 374 (370 residues), 184.6 bits, see alignment E=2e-58

Best Hits

KEGG orthology group: None (inferred from 49% identity to aci:ACIAD1001)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>MPMX26_01922 hypothetical protein (Acinetobacter radioresistens SK82)
MLKLLHNQLGILIAPFIFIASLTGLLYGLTPQLESFIYKEQLSALHSPNHKTQPLSQQVA
AASIFLPHDAKIFAVRTPQTSEHTTRILYQVPNNPDTVKAIFINPYTLKVQGQLPVYGTS
GVLPLRTFLDQLHRSLLLGEYGRIYSEFAASWLGLFALTGLIQWWSYRKKNKSIHSRHSR
IKWHYIFGLTVLPMLFFFSLTGLTWSKWSGANIAQLRHLLNSDTPTLYLALNPKTMNVTN
PHAEHYMQMDMPGQHLSTTLNFKDFDRIVELAHQNGLNAQALQIKPSYQKDRAWSIEEMN
HRWPIQIDALAVDMSTQHIIDHLRFSDFPLSAKLTRWGVDLHIGVLFGWLNQVLLVLSAA
IILLVLIFSYQAWWTYQRPLDTLRKFNQDLWQQWKNCNQFQKIIYISILFGLYFLLPVWT
ISVVLLQLIATVFHYLSLKKSHKN