Protein Info for MPMX26_01899 in Acinetobacter radioresistens SK82

Annotation: Anthranilate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03231: anthranilate 1,2-dioxygenase, small subunit
  • amino acids 9 to 163 (155 residues), 286.3 bits, E=3.3e-90
• PF00866: Ring_hydroxyl_B
  • amino acids 15 to 156 (142 residues), 156.1 bits, E=3.3e-50

Best Hits

Swiss-Prot: 84% identical to ANTDB_ACIAD: Anthranilate 1,2-dioxygenase small subunit (antB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05600, anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC: 1.14.12.1] (inferred from 90% identity to acd:AOLE_09975)

MetaCyc: 84% identical to anthranilate dioxygenase oxygenase component small subunit (Acinetobacter)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"Anthranilate dioxygenase small subunit" in subsystem Aromatic amino acid degradation

MetaCyc Pathways

• anthranilate degradation I (aerobic) (1/1 steps found)
• 2-nitrobenzoate degradation II (1/3 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (9/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Carbazole degradation
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.1

Use Curated BLAST to search for 1.14.12.1

Protein Sequence (163 amino acids)

>MPMX26_01899 Anthranilate 1,2-dioxygenase small subunit (Acinetobacter radioresistens SK82)
MSQELHFAVSQFLYRKAELCDAYEWDDYLELYDEDSEYHIPQWIDDHTYVQDPNQGLSYI
YYADRSGLEDRVFRIRTGKAASATPLPRTLHSINNIRVKMLEDGLIQANVVWQTLYNRQG
LEGCFYGHATYILRKTEETFRIRRQHTILLNDKIDSVLDFYHV