Protein Info for MPMX26_01891 in Acinetobacter radioresistens SK82

Annotation: Rhodocoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF07992: Pyr_redox_2" amino acids 3 to 297 (295 residues), 193 bits, see alignment E=2.4e-60 PF00070: Pyr_redox" amino acids 145 to 220 (76 residues), 51.3 bits, see alignment E=4.3e-17 PF13450: NAD_binding_8" amino acids 148 to 187 (40 residues), 27.1 bits, see alignment 1.3e-09 PF14759: Reductase_C" amino acids 316 to 401 (86 residues), 60.1 bits, see alignment E=7.2e-20

Best Hits

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 82% identity to abc:ACICU_00912)

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.3

Use Curated BLAST to search for 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>MPMX26_01891 Rhodocoxin reductase (Acinetobacter radioresistens SK82)
MERIVIVGAGQASGWAVSTLRQNGFSGEIHVVSNEEQVFYERPPLSKQVLSREADYESLS
LFSADQIESFNIQWHKPAFATQLDRQHKQVILQDGKTLPYDKLLIATGSRARIPVKTWQF
IPNVLTLRNVQDCEYLAERLEKANKVAVVGGGWIGLEIAATARKQGKQVHVFEYGDRLCA
RSVSPELSSVLKQIHEQQGTVIHLKSKHLHLVEAYQQKVEVVNYPQASELFDCVVVGAGA
EIAKELGSNAGLNVKDGIVVNCFGQTSDQDIYAAGDVAIHPGLGYCIQSWANAQNQAIAA
AKSMLGIATEYNDIPWLWSDQYHFNIQILGNYQPEKTKEVIIRQGGENQVSYLYLDHENR
LLNMVAINDSKLVKLAKRWIQSETQLNPEQLQDPEFNVMKLKP