Protein Info for MPMX26_01869 in Acinetobacter radioresistens SK82

Annotation: Glutathione peroxidase BsaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF00255: GSHPx" amino acids 4 to 110 (107 residues), 133.4 bits, see alignment E=2.4e-43 PF00578: AhpC-TSA" amino acids 6 to 95 (90 residues), 29 bits, see alignment E=8.8e-11

Best Hits

Swiss-Prot: 58% identical to GPO_LACLM: Glutathione peroxidase (gpo) from Lactococcus lactis subsp. cremoris (strain MG1363)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 84% identity to aci:ACIAD2085)

MetaCyc: 53% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>MPMX26_01869 Glutathione peroxidase BsaA (Acinetobacter radioresistens SK82)
MTNIYQFEAELLDGKTKSMADYRGKVLLIVNTASKCGFTPQFAGLEKVYQKYKDQGLEVL
GFPCNQFGGQDPGTNDQIGAFCQKNYGVSFPMFAKVDVKGPEAHAVFRYLTNNSKGILGN
GIKWNFTKFLVGKNGEVLNRYAPTSKPEALEEDIERALAQ