Protein Info for MPMX26_01866 in Acinetobacter radioresistens SK82

Annotation: Formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF22660: RS_preATP-grasp-like" amino acids 15 to 112 (98 residues), 35.8 bits, see alignment E=1.8e-12 TIGR01142: phosphoribosylglycinamide formyltransferase 2" amino acids 15 to 398 (384 residues), 555.6 bits, see alignment E=2.6e-171 PF02222: ATP-grasp" amino acids 123 to 308 (186 residues), 176.6 bits, see alignment E=8.2e-56 PF07478: Dala_Dala_lig_C" amino acids 139 to 296 (158 residues), 37 bits, see alignment E=5.4e-13 PF21244: PurT_C" amino acids 328 to 396 (69 residues), 84.7 bits, see alignment E=5.1e-28

Best Hits

Swiss-Prot: 86% identical to PURT_ACIBT: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 86% identity to aby:ABAYE2179)

MetaCyc: 58% identical to phosphoribosylglycinamide formyltransferase monomer (Methanocaldococcus jannaschii)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 6.3.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX26_01866 Formate-dependent phosphoribosylglycinamide formyltransferase (Acinetobacter radioresistens SK82)
MSVTIGTPLQSSAVKVLLLGSGELGKEVVISLQRLGVEVHAADRYEHAPAMQVAHFSYSL
NMADPQQLKALIEQVKPQFIVPEIEAIATEVLLEVEAGQQAVVIPSAKAVNLTMNREGIR
RLAAEELGLPTSAYRFADSLESFRAACDDIGYPNFVKPVMSSSGKGQSRVKSFDEVDAAW
EYAQTGGRVNQGKVIVESQIDFDFEITLLAVRAKNPQSGKIETSFCDPIGHRQDSGDYVE
SWQPQPMSPVALEESKRIADKVTAALGGCGVFGVELFIKGDQVWFSEVSPRPHDTGLVTL
ASQFQSEFELHARAILGLVVNTARHSVAASAVIYAGQDGSNLSFSGLDLALAHPSTDLRL
FGKPEGFKRRRMGVATARAATIEEARELAQQTAAQVIVNSNP