Protein Info for MPMX26_01866 in Acinetobacter radioresistens SK82

Annotation: Formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01142: phosphoribosylglycinamide formyltransferase 2
  • amino acids 15 to 398 (384 residues), 555.6 bits, E=2.6e-171
• PF02222: ATP-grasp
  • amino acids 125 to 302 (178 residues), 165.9 bits, E=1e-52
• PF07478: Dala_Dala_lig_C
  • amino acids 139 to 296 (158 residues), 37 bits, E=4e-13
• PF21244: PurT_C
  • amino acids 328 to 396 (69 residues), 84.1 bits, E=5.9e-28

Best Hits

Swiss-Prot: 86% identical to PURT_ACIBT: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 86% identity to aby:ABAYE2179)

MetaCyc: 58% identical to phosphoribosylglycinamide formyltransferase monomer (Methanocaldococcus jannaschii)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 6.3.1.21

Protein Sequence (402 amino acids)

>MPMX26_01866 Formate-dependent phosphoribosylglycinamide formyltransferase (Acinetobacter radioresistens SK82)
MSVTIGTPLQSSAVKVLLLGSGELGKEVVISLQRLGVEVHAADRYEHAPAMQVAHFSYSL
NMADPQQLKALIEQVKPQFIVPEIEAIATEVLLEVEAGQQAVVIPSAKAVNLTMNREGIR
RLAAEELGLPTSAYRFADSLESFRAACDDIGYPNFVKPVMSSSGKGQSRVKSFDEVDAAW
EYAQTGGRVNQGKVIVESQIDFDFEITLLAVRAKNPQSGKIETSFCDPIGHRQDSGDYVE
SWQPQPMSPVALEESKRIADKVTAALGGCGVFGVELFIKGDQVWFSEVSPRPHDTGLVTL
ASQFQSEFELHARAILGLVVNTARHSVAASAVIYAGQDGSNLSFSGLDLALAHPSTDLRL
FGKPEGFKRRRMGVATARAATIEEARELAQQTAAQVIVNSNP