Protein Info for MPMX26_01859 in Acinetobacter radioresistens SK82

Annotation: Methionine import ATP-binding protein MetN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 34 to 182 (149 residues), 132.3 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 72% identical to METN1_ACIAD: Methionine import ATP-binding protein MetN 1 (metN1) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 72% identity to aci:ACIAD2069)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MPMX26_01859 Methionine import ATP-binding protein MetN (Acinetobacter radioresistens SK82)
MVSFGSHTEFTVSHIKIRNLNKYYQVQGKSVHALKNISLDIPEGKIFGIIGKSGAGKSSL
LRTLNGLEQPSNGSIHIHQQDLASLNHAELIRLRQRIGMIFQHFNLMSAKTVWENVALPL
KISAHKKAEIELRVNEALELVGLSSKAENYPSQLSGGQKQRVGIARALVHRPEILLCDEA
TSALDPESTSVILSLLKRINQQMGITIVLITHEMQVIREICDQVVVIDQGEIVESGQVWS
VFSKPEQQITQGLLTLEQLDLPFAVNSKVTTETTHTILKLCYESAIHHTPDLKVILEQLN
GPVHLYQGHVDTIQQHLIGSLIVAIPDVQLNLKHLKEALKQYIAHIEVLGYARPAH