Protein Info for MPMX26_01854 in Acinetobacter radioresistens SK82

Annotation: Dibenzothiophene desulfurization enzyme C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR04022: sulfur acquisition oxidoreductase, SfnB family" amino acids 10 to 400 (391 residues), 495.5 bits, see alignment E=4.9e-153 PF02771: Acyl-CoA_dh_N" amino acids 32 to 121 (90 residues), 37.2 bits, see alignment E=6.9e-13 PF02770: Acyl-CoA_dh_M" amino acids 135 to 215 (81 residues), 36 bits, see alignment E=1.3e-12 PF08028: Acyl-CoA_dh_2" amino acids 242 to 375 (134 residues), 55 bits, see alignment E=2.3e-18 PF00441: Acyl-CoA_dh_1" amino acids 244 to 373 (130 residues), 26.9 bits, see alignment E=9.8e-10

Best Hits

KEGG orthology group: None (inferred from 81% identity to abc:ACICU_01528)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>MPMX26_01854 Dibenzothiophene desulfurization enzyme C (Acinetobacter radioresistens SK82)
MTHITQTPAYIIENDQQALNAAYQVADFALNTRNERDQCRILPIEEIEQFSFKGLGGIRI
PKAFGGAFVSNKTLAQVFRILSKADANVGQIPQNQIALLNMINMMGNEQQKKFIFSEILH
GKRLANGGPERYTKDSKTLETTLSVKDGQYILNGEKFYSTGSSFAHWLAIKAVHPEGHVV
LVIIDAQEKGVEVINDWYGFGQRTTASGTVRLNQVRVNPDLIFDERKLYEKPNYRGAYSQ
LLQVAIDVGIAEAAFAETLTAVHKARPIIDAQVEKASSEHYTLQEVGKLNILLDASILLL
DEAAEYLDELDQHKIVTAEQAAQASIRVAEAKVYANDAALQISEKLLELGGSRSCLSQHH
LDQYWRNARVHTLHDPVRWKLHAIGNYYLNQAFPARHAWI