Protein Info for MPMX26_01851 in Acinetobacter radioresistens SK82

Annotation: putative transcriptional regulatory protein YebC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 238 (238 residues), 318.6 bits, see alignment E=1.5e-99 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 111.6 bits, see alignment E=2e-36 PF01709: Transcrip_reg" amino acids 83 to 237 (155 residues), 195.7 bits, see alignment E=4.3e-62

Best Hits

Swiss-Prot: 93% identical to Y1496_ACIBT: Probable transcriptional regulatory protein A1S_1496 (A1S_1496) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 92% identity to acd:AOLE_11190)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>MPMX26_01851 putative transcriptional regulatory protein YebC (Acinetobacter radioresistens SK82)
MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGPDAASNPRLRAVVEKALSVN
MTRDTINRAIQRGAGGEDNDDLKEITYEGYGTGGVAVLVETMTDNLNRTVPDVRHCFSKT
NGNLGTSGSVAYLFTKRGEISFDDLSLEEKILEVALEAGAEDIEISEDEILVITTPESFG
DVQDALSAAGLKSDNAEVVMSPSTKAEITDIDQAKQIMKMIDMLEDLDDVQNVYTNVEFS
DEVLAQLDA