Protein Info for MPMX26_01776 in Acinetobacter radioresistens SK82

Annotation: S-adenosylmethionine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR01034: methionine adenosyltransferase" amino acids 6 to 384 (379 residues), 622.8 bits, see alignment E=1e-191 PF00438: S-AdoMet_synt_N" amino acids 6 to 102 (97 residues), 147.4 bits, see alignment E=2.3e-47 PF02772: S-AdoMet_synt_M" amino acids 115 to 232 (118 residues), 161.5 bits, see alignment E=1.3e-51 PF02773: S-AdoMet_synt_C" amino acids 234 to 375 (142 residues), 227 bits, see alignment E=1e-71

Best Hits

Swiss-Prot: 97% identical to METK_ACIBS: S-adenosylmethionine synthase (metK) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 96% identity to aby:ABAYE2118)

MetaCyc: 74% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>MPMX26_01776 S-adenosylmethionine synthase (Acinetobacter radioresistens SK82)
MREYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITT
TANVDVEAIVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVDRQKPEDQGAGD
QGLMFGYASRETDVLMPAPISYAHRLMERQAELRRSGALPWLRPDAKSQVTFAYENGRPV
RLDAVVLSTQHDPEITQAQLKEAVLEEIIKPVIPAEMFHVATKFHINPTGMFVIGGPVGD
CGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNIVAAGLAEKCEIQV
SYAIGVAEPTSISINTFNTAKVSEELIIQLVREHFDLRPYGITRMLNLIQPMYKQTAAYG
HFGREGSDTAFTWEKTDKVEALKASAGL