Protein Info for MPMX26_01705 in Acinetobacter radioresistens SK82

Annotation: Alpha-ketoglutarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 216 (196 residues), 85.8 bits, see alignment E=4.8e-28 amino acids 215 to 421 (207 residues), 46 bits, see alignment E=5.4e-16 PF07690: MFS_1" amino acids 25 to 265 (241 residues), 72.5 bits, see alignment E=4.7e-24 amino acids 249 to 425 (177 residues), 54.2 bits, see alignment E=1.7e-18 PF12832: MFS_1_like" amino acids 261 to 419 (159 residues), 35.9 bits, see alignment E=7.1e-13

Best Hits

KEGG orthology group: K02625, MFS transporter, MHS family, dicarboxylic acid transporter PcaT (inferred from 90% identity to aci:ACIAD1651)

Predicted SEED Role

"dicarboxylic acid transporter PcaT" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MPMX26_01705 Alpha-ketoglutarate permease (Acinetobacter radioresistens SK82)
MSEVIYTKEEKRKRVLGIVGASSGNLVEWFDFYIYAVFAMYFQHALTAPDMTSTAQGIYV
WGVFAASFFMRPIGSWLFGRIADTRGRKQSMVISISLMAISSFLFALLPTYEQVGMAAPF
LLLLVRLLQGLSVGGEYGAVATYMSEIALKGQRGFYASFQYVTLSGGQLLASLLGVILLA
FMSEQQLMDGGWRIPFVIGGITAIISLLARSRLEETLSHEDSERKESGSLRELFQKHWKT
FLLVVGYTSAGSLTFYVITVYSKTYLTNIGIDGKTVGFMMTCALFVFMLAQPIFGMISDR
IGRRASMLLFSATSAIFIYPVMVVGMRHFSYSPVIVTLLLIFLMMLLSFYTSISGLVKAE
MFPTHVRALGVGFSYAVGNALFGGSAPAVALKFKEAGFENTFFVYVIVMLVICFLCSFAL
PKEPEYLHHDH